Jump to content

  • Log in with Facebook Log in with Twitter Log in with Windows Live Log In with Google      Sign In   
  • Create Account

Submit your paper to J Biol Methods today!
Photo

30 new peptides-Chinese Peptide Company


  • Please log in to reply
No replies to this topic

#1 peptide1

peptide1

    member

  • Members
  • Pip
  • 3 posts
0
Neutral

Posted 08 January 2014 - 07:14 PM

30 new peptides

The following peptides have been added to the catalog and are now available. For detailed information and ordering, please contact with sales@chinesepeptide.com. CPC always strives to become one of the most comprehensive suppliers of peptide chemistry services.

Catalog

Product Name

One Letter Sequence

AMYD-048A

Amyloid β/A4 Protein Precursor 770 (135-155)

FLHQERMDVCETHLHWHTVAK

AMYD-048B

Amyloid β/A4 Protein Precursor 770 (135-155)

FLHQERMDVCETHLHWHTVAK

AMYD-049A

Amyloid β/A4 Protein Precursor 770 (740-770)

AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

AMYD-049B

Amyloid β/A4 Protein Precursor 770 (740-770)

AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

AMYD-050A

(Arg6)-Amyloid β-Protein (1-40)

DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

AMYD-050B

(Arg6)-Amyloid β-Protein (1-40)

DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

AMYD-051A

Amyloid β-Protein (25-35)

GSNKGAIIGLM

AMYD-051B

Amyloid β-Protein (25-35)

GSNKGAIIGLM

AMYD-052A

Non-Aβ Component of Alzheimer's Disease Amyloid

EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV

AMYD-052B

Non-Aβ Component of Alzheimer's Disease Amyloid

EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV

MOG-002A

Myelin Oligodendrocyte Glycoprotein, MOG, (35-55) (human)

MEVGWYRPPFSRVVHLYRNGK-OH

MOG-002B

Myelin Oligodendrocyte Glycoprotein, MOG (35-55) (human)

MEVGWYRPPFSRVVHLYRNGK-OH

AAV2-001A

Adeno-Associated Virus Epitope 2 (AAV2)

VPQYGYLTL-OH

HIST-005A

Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap(Dnp)-NH2 Trifluoroacetate salt

Abz-GAK(Ac)-AA-Dap(Dnp)-NH2

HIST-005B

Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap(Dnp)-NH2 Trifluoroacetate salt

Abz-GAK(Ac)-AA-Dap(Dnp)-NH2

HIST-006A

Ac-RGK(Ac)-Amc

Ac-RGK(Ac)-Amc

HIST-006B

Ac-RGK(Ac)-Amc

Ac-RGK(Ac)-Amc

HIST-007A

Ac-Gly-Ala-Lys(Ac)-Amc

Ac-GAK(Ac)-Amc

HIST-007B

Ac-Gly-Ala-Lys(Ac)-Amc

Ac-GAK(Ac)-Amc

HIST-008A

Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2

Mca-GAK(Ac)-RHRKV-NH2

HIST-008B

Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2

Mca-GAK(Ac)-RHRKV-NH2

Catalog

Product Name

One Letter Sequence

HIST-009A

[pSer42]-Histone H1 (29-59), Tetrahymena thermophila

KDTKPTPTKGKAA-pS-ASTTPVKKDVTPVKADT

HIST-009B

[pSer42]-Histone H1 (29-59), Tetrahymena thermophila

KDTKPTPTKGKAA-pS-ASTTPVKKDVTPVKADT

HIST-010A

Histone H1 (29-59), Tetrahymena thermophila

KDTKPTPTKGKAASASTTPVKKDVTPVKADT

HIST-011A

Histone H1-derived Peptide

GGGPATPKKAKKL

HIST-012A

Histone H2A (1-20)

SGRGKQGGKARAKAKTRSSR

HIST-013A

Histone H2AX (134-143)

CKATQASQEY

HIST-014A

[Lys(Ac)12]-Histone H2B (1-22)-GGK(Biotin)-NH2; H2BK12(Ac), biotin-labeled

PEPAKSAPAPK-K(Ac)-GSKKAVTKAQ-GGK(Biotin)-NH2

HIST-014B

[Lys(Ac)12]-Histone H2B (1-22)-GGK(Biotin)-NH2; H2BK12(Ac), biotin-labeled

PEPAKSAPAPK-K(Ac)-GSKKAVTKAQ-GGK(Biotin)-NH2

HIST-015A

Histone H2B (21-35)

AQKKDGKKRKRSRKE

HIST-016A

Histone H2B (21-41), biotin labeled

AQKKDGKKRKRSRKESYSIYVGG-K(Biotin)

HIST-016B

Histone H2B (21-41), biotin labeled

AQKKDGKKRKRSRKESYSIYVGG-K(Biotin)

HIST-017A

K(biotin)-W-Histone H2B (108-125); H2B, N-Terminal biotin-labeled  NEW

K(biotin)-WKHAVSEGTKAVTKYTSSK

HIST-017B

K(biotin)-W-Histone H2B (108-125); H2B, N-Terminal biotin-labeled  NEW

K(biotin)-WKHAVSEGTKAVTKYTSSK

HIST-018A

[Lys(Ac)79]-Histone H3 (73-83), H3K79(Ac) 

EIAQDF-K(Ac)-TDLR

HIST-018B

[Lys(Ac)79]-Histone H3 (73-83), H3K79(Ac) 

EIAQDF-K(Ac)-TDLR

HIST-019A

[Lys(Me3)79]-Histone H3(73-83), H3K79(Me3) 

EIAQDF-K(Me3)-TDLR

HIST-019B

[Lys(Me3)79]-Histone H3(73-83), H3K79(Me3) 

EIAQDF-K(Me3)-TDLR

HIST-020A

[Lys(Me1)4]-Histone H3 (1-10), H3K4(Me1)

ART-K(Me1)-QTARKS

HIST-021A

[Lys(Me1)4]-Histone H3 (1-10), H3K4(Me2)

ART-K(Me2)-QTARKS

HIST-022A

[Lys(Me1)4]-Histone H3 (1-10), H3K4(Me3)

ART-K(Me3)-QTARKS

HIST-023A

[pSer10]-Histone H3 (1-15); H3pS10

ARTKQTARK-pS-TGGKA

HIST-024A

Histone H3 (1-18)-WC, amide

ARTKQTARKSTGGKAPRKWC-NH2

HIST-025A

[Lys(Ac)14]-Histone H3 (1-19), H3K14(Ac)

ARTKQTARKSTGG-K(Ac)-APRKQ

HIST-026A

Histone H3 (1-20), N-Terminal

ARTKQTARKSTGGKAPRKQL

HIST-027A

[Lys(Ac)9]-Histone H3 (1-20), H3K9(Ac)

ARTKQTAR-K(Ac)-STGGKAPRKQL

 

Attached Thumbnails

  • 14年英文新品2大_副本.jpg
  • 14年英文新品大_副本.jpg





Home - About - Terms of Service - Privacy - Contact Us

©1999-2013 Protocol Online, All rights reserved.