 |
BioProduct : Custom Services : Peptide Synthesis : Beta Amyloid peptides
| Product Name | Beta Amyloid peptides |
| Product Page | Visit the Product |
| Product Description | A range of Beta Amyloids are available. For example the Beta Amyloid 1-40. Sequence: (NH2-) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (-COOH) |
| Product Manual | Read Product Manual |
| Price | |
| Specification | 1 mg |
| Product Review |
0
 |
| Vendor Information |
Innovagen http://www.innovagen.com |